PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10015924
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family Trihelix
Protein Properties Length: 529aa    MW: 60132.9 Da    PI: 8.0419
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10015924genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix46.97.2e-15128204281
     trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpy 81 
                  W+++evl L+++r++me +     +++  We+vs++++e gf+rs+++Ckek+e+ +++   i+++++  ++ ++  ++ 
  Lus10015924 128 WSNDEVLSLLRIRSSMELNW--FPSAEFTWEHVSRRLSEVGFKRSAEKCKEKFEEESRYINTINNNNNH-SNYHRAAFSS 204
                  ****************8554..45589****************************98877777776664.5655555555 PP

2trihelix91.31e-28396508186
     trihelix   1 rWtkqevlaLiearremeerlrrgk............................lkkplWeevskkmrergferspkqCkekwenlnkrykkikegekk 70 
                  rW+++evlaLi++r  + ++++++                              k+plWe++s+ m e g++rs+k+Ckekwen+nk+++k+k+ +kk
  Lus10015924 396 RWPRDEVLALINLRCGIYNNYNNAGgrndvvaaavaekeggggggglasnsnnNKAPLWERISSGMLELGYRRSAKRCKEKWENINKYFRKTKDLNKK 493
                  8**************77777776544456677777777788888888888888********************************************* PP

     trihelix  71 rtsessstcpyfdqle 86 
                  r s +s+tcpyf+ql 
  Lus10015924 494 R-SLDSRTCPYFHQLS 508
                  8.9999********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007178.1124184IPR001005SANT/Myb domain
PfamPF138379.0E-10126197No hitNo description
PROSITE profilePS500906.04128182IPR017877Myb-like domain
SMARTSM007171.3393483IPR001005SANT/Myb domain
PfamPF138377.8E-17395509No hitNo description
CDDcd122031.60E-22395488No hitNo description
PROSITE profilePS500905.459454481IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0001158Molecular Functionenhancer sequence-specific DNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MFEGVAPPSD QFHKFTPPNA SHPSSPSPHL PLHLSFTSSS SSPTPPIFPL SFDPYHHQHH  60
QHQVLPPVEP SILLQPNFFH PLSFNPHSNN TAGGATTRSI DIKNINHHED KELVEAAASI  120
IQQQDPAWSN DEVLSLLRIR SSMELNWFPS AEFTWEHVSR RLSEVGFKRS AEKCKEKFEE  180
ESRYINTINN NNNHSNYHRA AFSSHDDLQN NKKREKRKRE GDKFEMFKGF CQDIVDKMMA  240
QQEEMQNKLI EDMIKRDQEK LASEEAWKKQ EMDRINQDLQ LRSNQQSLAG NRQSFILKFL  300
ENFPNPHQLV DPYHHSLQKV PIMVNNNIGY HPIPTSSSSS SAASQPNPKH TEYQSHPIQK  360
DGNPDSKSNN NPPNPSRKPI DVGELENRQR EEVGKRWPRD EVLALINLRC GIYNNYNNAG  420
GRNDVVAAAV AEKEGGGGGG GLASNSNNNK APLWERISSG MLELGYRRSA KRCKEKWENI  480
NKYFRKTKDL NKKRSLDSRT CPYFHQLSSL YGGNAATEEP GTVPEILQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00011PBMTransfer from AT5G28300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50433355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28300.13e-62Trihelix family protein